Skip to content

spock/prokka

 
 

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

208 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

Prokka: rapid prokaryotic genome annotation

Torsten Seemann ([email protected]) (@torstenseemann)

##Contents

##Introduction

Whole genome annotation is the process of identifying features of interest in a set of genomic DNA sequences, and labelling them with useful information. Prokka is a software tool to annotate bacterial, archaeal and viral genomes quickly and produce standards-compliant output files.

##Installation

Before the main install can begin you need to install some system packages:

Centos/Fedora/RHEL (RPM)

sudo yum install perl-Time-Piece perl-XML-Simple perl-Digest-MD5

Ubuntu/Debian/Mint (APT)

sudo apt-get install libdatetime-perl libxml-simple-perl libdigest-md5-perl bioperl

Mac OS X

sudo cpan Time::Piece XML::Simple Bio::Perl Digest::MD5

There are currently 3 ways to install the main Prokka software: Github, Tarball or Homebrew.

###Github

Choose somewhere to put it, for example in your home directory (no root access required):

% cd $HOME

Clone the latest version of the repository:

% git clone https://github.com/tseemann/prokka.git
% ls prokka

Index the sequence databases

% prokka/bin/prokka --setupdb

###Homebrew

Homebrew is a package manager which allows users to easily install complex software in their home directory. Instructions for installing it are available for Linux and Mac OS X.

Ensure you have brew installed:

% brew

Make sure you have the homebrew-science tap/channel enabled:

% brew tap homebrew/science
% brew update

Install Prokka and all its dependencies:

% brew install prokka --HEAD

###Tarball

WARNING: this method gives you very old version of prokka. The brew or github methods are preferred!

Download the latest prokka-1.xx.tar.gz archive from http://www.bioinformatics.net.au/software.prokka.shtml

% wget http://www.vicbioinformatics.com/prokka-1.11.tar.gz

Choose somewhere to put it, for example in your home directory (no root access required):

% cd $HOME
% tar zxvf prokka-1.11.tar.gz
% ls prokka-1.11

###Install dependencies

Prokka comes with many binaries for Linux and Mac OS X. It will always use your existing installed versions if they exist, but will use the included ones if that fails. For some older systems (eg. Centos 4.x) some of them won't work due to them being dynamically linked against new GLIBC libraries you don't have. You can consult the list of dependencies later in this document.

###Choose a rRNA predictor

####Option 1 - Don't use one

If Prokka can't find a predictor for rRNA featues (either Barrnap or RNAmmer below) then it simply won't annotate any. Most people don't care that much about them anyway,

####Option 2 - Barrnap

This was written by the author of Prokka and is recommended if you prefer speed over absolute accuracy. It uses the new multi-core NHMMER for DNA:DNA profile searches. Download it from https://github.com/tseemann/barrnap

####Option 3 - RNAmmer

RNAmmer was written when HMMER 2.x was the latest release. Since them, HMMER 3.x has been released, and uses the same executable binary names. Prokka needs HMMER3 and RNAmmer (and hence HMMER2) so you need to edit your RNAmmer script to explicitly point your HMMER2 binary instead of using the HMMER3 binary which is more likely to be in your PATH first.

Type which rnammer to find the script, and then edit it with your favourite editor. Find the following lines at the top:

if ( $uname eq "Linux" ) {
#       $HMMSEARCH_BINARY = "/usr/cbs/bio/bin/linux64/hmmsearch";    # OLD
        $HMMSEARCH_BINARY = "/path/to/my/hmmer-2.3.2/bin/hmmsearch"; # NEW (yours)
}

If you are using Mac OS X, you'll also have to change the "Linux" to "Darwin" too. As you can see, I have commented out the original part, and replaced it with the location of my HMMER2 hmmsearch tool, so it doesn't run the HMMER3 one. You need to ensure HMMER3 is in your PATH before the old HMMER2 too.

Add to PATH

Add the following line to your $HOME/.bashrc file, or to /etc/profile.d/prokka.sh to make it available to all users:

export PATH=$PATH:$HOME/prokka-1.11/bin

Index the sequence databases

% prokka --setupdb

###Test

  • Type prokka and it should output it's help screen.
  • Type prokka --version and you should see an output like prokka 1.x
  • Type prokka --listdb and it will show you what databases it has installed to use.

##Invoking Prokka

###Beginner

# Vanilla (but with free toppings)
% prokka contigs.fa

# Look for a folder called PROKKA_yyyymmdd (today's date) and look at stats
% cat PROKKA_yyyymmdd/*.txt

###Moderate

# Choose the names of the output files
% prokka --outdir mydir --prefix mygenome contigs.fa

# Visualize it in Artemis
% art mydir/mygenome.gff

###Expert

# It's not just for bacteria, people
% prokka --kingdom Archaea --outdir mydir --genus Pyrococcus --locustag PYCC

# Search for my favourite gene
% exonerate --bestn 1 zetatoxin.fasta mydir/PYCC_06072012.faa | less

###Wizard

# Watch and learn
% prokka --outdir mydir --locustag EHEC --proteins NewToxins.faa --evalue 0.001 --gram neg --addgenes contigs.fa

# Check to see if anything went really wrong
% less mydir/EHEC_06072012.err

# Add final details using Sequin
% sequin mydir/EHEC_0607201.sqn

###NCBI Genbank submitter

# Register your BioProject (e.g. PRJNA123456) and your locus_tag prefix (e.g. EHEC) first!
% prokka --compliant --centre UoN --outdir PRJNA123456 --locustag EHEC --prefix EHEC-Chr1 contigs.fa

# Check to see if anything went really wrong
% less PRJNA123456/EHEC-Chr1.err

# Add final details using Sequin
% sequin PRJNA123456/EHEC-Chr1.sqn

###European Nucleotide Archive (ENA) submitter

# Register your BioProject (e.g. PRJEB12345) and your locus_tag (e.g. EHEC) prefix first!
% prokka --compliant --centre UoN --outdir PRJEB12345 --locustag EHEC --prefix EHEC-Chr1 contigs.fa

# Check to see if anything went really wrong
% less PRJNA123456/EHEC-Chr1.err

# Install and run Sanger Pathogen group's Prokka GFF3 to EMBL converter
# available from https://github.com/sanger-pathogens/gff3toembl
# Find the closest NCBI taxonomy id (e.g. 562 for Escherichia coli)
% gff3_to_embl -i "Submitter, A." \
    -m "Escherichia coli EHEC annotated using Prokka." \
    -g linear -c PROK -n 11 -f PRJEB12345/EHEC-Chr1.embl \
    "Escherichia coli" 562 PRJEB12345 "Escherichia coli strain EHEC" PRJEB12345/EHEC-Chr1.gff

# Download and run the latest EMBL validator prior to submitting the EMBL flat file
# from http://central.maven.org/maven2/uk/ac/ebi/ena/sequence/embl-api-validator/
# which at the time of writing is v1.1.129
% curl -L -O http://central.maven.org/maven2/uk/ac/ebi/ena/sequence/embl-api-validator/1.1.129/embl-api-validator-1.1.129.jar
% java -jar embl-api-validator-1.1.129.jar -r PRJEB12345/EHEC-Chr1.embl

# Compress the file ready to upload to ENA, and calculate MD5 checksum
% gzip PRJEB12345/EHEC-Chr1.embl
% md5sum PRJEB12345/EHEC-Chr1.embl.gz

###Crazy Person

# No stinking Perl script is going to control me
% prokka \
        --outdir $HOME/genomes/Ec_POO247 --force \
        --prefix Ec_POO247 --addgenes --locustag ECPOOp \
        --increment 10 --gffver 2 --centre CDC  --compliant \
        --genus Escherichia --species coli --strain POO247 --plasmid pECPOO247 \
        --kingdom Bacteria --gcode 11 --usegenus \
        --proteins /opt/prokka/db/trusted/Ecocyc-17.6 \
        --evalue 1e-9 --rfam \
        plasmid-closed.fna

##Output Files

Extension Description
.gff This is the master annotation in GFF3 format, containing both sequences and annotations. It can be viewed directly in Artemis or IGV.
.gbk This is a standard Genbank file derived from the master .gff. If the input to prokka was a multi-FASTA, then this will be a multi-Genbank, with one record for each sequence.
.fna Nucleotide FASTA file of the input contig sequences.
.faa Protein FASTA file of the translated CDS sequences.
.ffn Nucleotide FASTA file of all the annotated sequences, not just CDS.
.sqn An ASN1 format "Sequin" file for submission to Genbank. It needs to be edited to set the correct taxonomy, authors, related publication etc.
.fsa Nucleotide FASTA file of the input contig sequences, used by "tbl2asn" to create the .sqn file. It is mostly the same as the .fna file, but with extra Sequin tags in the sequence description lines.
.tbl Feature Table file, used by "tbl2asn" to create the .sqn file.
.err Unacceptable annotations - the NCBI discrepancy report.
.log Contains all the output that Prokka produced during its run. This is a record of what settings you used, even if the --quiet option was enabled.
.txt Statistics relating to the annotated features found.

##Command line options

General:
  --help            This help
  --version         Print version and exit
  --docs            Show full manual/documentation
  --citation        Print citation for referencing Prokka
  --quiet           No screen output (default OFF)
  --debug           Debug mode: keep all temporary files (default OFF)
Setup:
  --listdb          List all configured databases
  --setupdb         Index all installed databases
  --cleandb         Remove all database indices
  --depends         List all software dependencies
Outputs:
  --outdir [X]      Output folder [auto] (default '')
  --force           Force overwriting existing output folder (default OFF)
  --prefix [X]      Filename output prefix [auto] (default '')
  --addgenes        Add 'gene' features for each 'CDS' feature (default OFF)
  --locustag [X]    Locus tag prefix (default 'PROKKA')
  --increment [N]   Locus tag counter increment (default '1')
  --gffver [N]      GFF version (default '3')
  --compliant       Force Genbank/ENA/DDJB compliance: --genes --mincontiglen 200 --centre XXX (default OFF)
  --centre [X]      Sequencing centre ID. (default '')
Organism details:
  --genus [X]       Genus name (default 'Genus')
  --species [X]     Species name (default 'species')
  --strain [X]      Strain name (default 'strain')
  --plasmid [X]     Plasmid name or identifier (default '')
Annotations:
  --kingdom [X]     Annotation mode: Archaea|Bacteria|Mitochondria|Viruses (default 'Bacteria')
  --gcode [N]       Genetic code / Translation table (set if --kingdom is set) (default '0')
  --gram [X]        Gram: -/neg +/pos (default '')
  --usegenus        Use genus-specific BLAST databases (needs --genus) (default OFF)
  --proteins [X]    Fasta file of trusted proteins to first annotate from (default '')
  --hmms [X]        Trusted HMM to first annotate from (default '')
  --metagenome      Improve gene predictions for highly fragmented genomes (default OFF)
  --rawproduct      Do not clean up /product annotation (default OFF)
Computation:
  --fast            Fast mode - skip CDS /product searching (default OFF)
  --cpus [N]        Number of CPUs to use [0=all] (default '8')
  --mincontiglen [N] Minimum contig size [NCBI needs 200] (default '1')
  --evalue [n.n]    Similarity e-value cut-off (default '1e-06')
  --rfam            Enable searching for ncRNAs with Infernal+Rfam (SLOW!) (default '0')
  --norrna          Don't run rRNA search (default OFF)
  --notrna          Don't run tRNA search (default OFF)
  --rnammer         Prefer RNAmmer over Barrnap for rRNA prediction (default OFF)

##Databases

###The Core (BLAST+) Databases

Prokka uses a variety of databases when trying to assign function to the predicted CDS features. It takes a hierarchial approach to make it fast.
A small, core set of well characterized proteins are first searched using BLAST+. This combination of small database and fast search typically completes about 70% of the workload. Then a series of slower but more sensitive HMM databases are searched using HMMER3.

The initial core databases are derived from UniProtKB; there is one per "kingdom" supported. To qualify for inclusion, a protein must be (1) from Bacteria (or Archaea or Viruses); (2) not be "Fragment" entries; and (3) have an evidence level ("PE") of 2 or lower, which corresponds to experimental mRNA or proteomics evidence.

####Making a Core Databases

If you want to modify these core databases, the included script prokka-uniprot_to_fasta_db, along with the official uniprot_sprot.dat, can be used to generate a new database to put in /opt/prokka/db/kingdom/. If you add new ones, the command prokka --listdb will show you whether it has been detected properly.

####The Genus Databases

If you enable --usegenus and also provide a Genus via --genus then it will first use a BLAST database which is Genus specific. Prokka comes with a set of databases for the most common Bacterial genera; type prokka --listdb to see what they are.

####Adding a Genus Databases

If you have a set of Genbank files and want to create a new Genus database, Prokka comes with a tool called prokka-genbank_to_fasta_db to help. For example, if you had four annotated "Coccus" genomes, you could do the following:

% prokka-genbank_to_fasta_db Coccus1.gbk Coccus2.gbk Coccus3.gbk Coccus4.gbk > Coccus.faa
% cd-hit -i Coccus.faa -o Coccus -T 0 -M 0 -g 1 -s 0.8 -c 0.9
% rm -fv Coccus.faa Coccus.bak.clstr Coccus.clstr
% makeblastdb -dbtype prot -in Coccus
% mv Coccus.p* /path/to/prokka/db/genus/

###The HMM Databases

Prokka comes with a bunch of HMM libraries for HMMER3. They are mostly Bacteria-specific. They are searched after the core and genus databases. You can add more simply by putting them in /opt/prokka/db/hmm. Type prokka --listdb to confirm they are recognised.

###FASTA database format

Prokka understands two annotation tag formats, a plain one and a detailed one.

The plain one is a standard FASTA-like line with the ID after the > sign, and the protein /product after the ID (the "description" part of the line):

>SeqID product

The detailed one consists of a special encoded three-part description line. The parts are the /EC_number, the /gene code, then the /product - and they are separated by a special "~~~" sequence:

>SeqID EC_number~~~gene~~~product

Here are some examples. Note that not all parts need to be present, but the "~~~" should still be there:

>YP_492693.1 2.1.1.48~~~ermC~~~rRNA adenine N-6-methyltransferase
MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEI
DHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIFGNIPYNISTDIIRKIVF*
>YP_492697.1 ~~~traB~~~transfer complex protein TraB
MIKKFSLTTVYVAFLSIVLSNITLGAENPGPKIEQGLQQVQTFLTGLIVAVGICAGVWIV
LKKLPGIDDPMVKNEMFRGVGMVLAGVAVGAALVWLVPWVYNLFQ*
>YP_492694.1 ~~~~~~transposase
MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRGRGVNVHHSTVYRWVQEYAPILYQ
QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS*

The same description lines apply to HMM models, except the "NAME" and "DESC" fields are used:

NAME  PRK00001
ACC   PRK00001
DESC  2.1.1.48~~~ermC~~~rRNA adenine N-6-methyltransferase
LENG  284

##FAQ

  • Where does the name "Prokka" come from?
    Prokka is a contraction of "prokaryotic annotation". It's also relatively unique within Google, and also rhymes with a native Australian marsupial called the quokka.

  • Can I annotate by eukaryote genome with Prokka?
    No. Prokka is specifically designed for Bacteria, Archaea and Viruses. It can't handle multi-exon gene models; I would recommend using MAKER 2 for that purpose.

  • Why does Prokka keeps on crashing when it gets to tge "tbl2asn" stage?
    It seems that the tbl2asn program from NCBI "expires" after 12 months, and refuses to run. Unfortunately you need to install a newer version which you can download from here.

  • The hmmscan step seems to hang and do nothing?
    The problem here is GNU Parallel. It seems the Debian package for hmmer has modified it to require the --gnu option to behave in the 'default' way. There is no clear reason for this. The only way to restore normal behaviour is to edit the prokka script and change parallel to parallel --gnu.

  • Why does prokka fail when it gets to hmmscan?
    Unfortunately HMMER keeps changing it's database format, and they aren't upward compatible. If you upgraded HMMER (from 3.0 to 3.1 say) then you need to "re-press" the files. This can be done as follows: cd /path/to/prokka/db/hmm mkdir new for D in *.hmm ; do hmmconvert $D > new/$D ; done cd new for D in *.hmm ; do hmmpress $D ; done mv * .. rmdir new

  • Why does Prokka take so long to download?
    Our server is in Australia, and the international pipes aren't always flowing as well as we'd like. I try to put it on GoogleDrive. Dropbox is no longer possible due to bandwidth quotas. If you are able to mirror Prokka (~2 GB) outside please let me know.

  • Why can't I load Prokka .GBK files into Mauve?
    Mauve uses BioJava to parse GenBank files, and it is very picky about Genbank files. It does not like long contig names, like those from Velvet or Spades. One solution is to use --centre XXX in Prokka and it will rename all your contigs to be NCBI (and Mauve) compliant. It does not like the ACCESSION and VERSION strings that Prokka produces via the "tbl2asn" tool. The following Unix command will fix them: egrep -v '^(ACCESSION|VERSION)' prokka.gbk > mauve.gbk

##Bugs

##Changes

##Citation

Seemann T.
Prokka: rapid prokaryotic genome annotation
Bioinformatics 2014 Jul 15;30(14):2068-9. PMID:24642063

##Dependencies

Mandatory

  • BioPerl
    Used for input/output of various file formats
    Stajich et al, The Bioperl toolkit: Perl modules for the life sciences. Genome Res. 2002 Oct;12(10):1611-8.

  • GNU Parallel
    A shell tool for executing jobs in parallel using one or more computers
    O. Tange, GNU Parallel - The Command-Line Power Tool, ;login: The USENIX Magazine, Feb 2011:42-47.

  • BLAST+
    Used for similarity searching against protein sequence libraries
    Camacho C et al. BLAST+: architecture and applications. BMC Bioinformatics. 2009 Dec 15;10:421.

  • Prodigal
    Finds protein-coding features (CDS)
    Hyatt D et al. Prodigal: prokaryotic gene recognition and translation initiation site identification. BMC Bioinformatics. 2010 Mar 8;11:119.

Recommended

  • Aragorn
    Finds transfer RNA features (tRNA)
    Laslett D, Canback B. ARAGORN, a program to detect tRNA genes and tmRNA genes in nucleotide sequences. Nucleic Acids Res. 2004 Jan 2;32(1):11-6.

  • Barrnap
    Used to predict ribosomal RNA features (rRNA). My licence-free replacement for RNAmmmer.
    Manuscript under preparation.

  • RNAmmer
    Finds ribosomal RNA features (rRNA)
    Lagesen K et al. RNAmmer: consistent and rapid annotation of ribosomal RNA genes. Nucleic Acids Res. 2007;35(9):3100-8.

  • HMMER3
    Used for similarity searching against protein family profiles
    Finn RD et al. HMMER web server: interactive sequence similarity searching. Nucleic Acids Res. 2011 Jul;39(Web Server issue):W29-37.

Optional

  • SignalP
    Finds signal peptide features in CDS (sig_peptide)
    Petersen TN et al. SignalP 4.0: discriminating signal peptides from transmembrane regions. Nat Methods. 2011 Sep 29;8(10):785-6.

  • Infernal
    Used for similarity searching against ncRNA family profiles
    D. L. Kolbe, S. R. Eddy. Fast Filtering for RNA Homology Search. Bioinformatics, 27:3102-3109, 2011.

About

Rapid prokaryotic genome annotation

Resources

Stars

Watchers

Forks

Packages

 
 
 

Contributors

Languages

  • Perl 99.4%
  • Shell 0.6%